PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10029746
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 311aa    MW: 35648.1 Da    PI: 8.2671
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10029746genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.43.3e-184691147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l ++v+q+G+++W++Ia ++  gR++k+c++rw++ 
      Lus10029746 46 RGHWRPAEDEKLRQLVHQYGPHNWNSIADKLK-GRSGKSCRLRWFNQ 91
                     899****************************9.***********996 PP

2Myb_DNA-binding52.89.1e-1798140145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      r ++T+ E+e+l  a++ +G++ W++I+r ++ gRt++ +k++w+
      Lus10029746  98 RRPFTEKEEERLMAAHRVHGNK-WALISRLFP-GRTDNAVKNHWH 140
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.1764192IPR017930Myb domain
SMARTSM007179.6E-154594IPR001005SANT/Myb domain
SuperFamilySSF466891.01E-2845139IPR009057Homeodomain-like
PfamPF002491.6E-174691IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-264799IPR009057Homeodomain-like
CDDcd001673.86E-134990No hitNo description
PROSITE profilePS5129424.95793147IPR017930Myb domain
SMARTSM007177.9E-1397145IPR001005SANT/Myb domain
PfamPF002496.8E-1498140IPR001005SANT/Myb domain
CDDcd001673.34E-9100140No hitNo description
Gene3DG3DSA:1.10.10.603.6E-20100146IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MAESSADAAI NTSCNERRSD VILTSSYSPS SSSSSYSHYN SSSCLRGHWR PAEDEKLRQL  60
VHQYGPHNWN SIADKLKGRS GKSCRLRWFN QLDPRINRRP FTEKEEERLM AAHRVHGNKW  120
ALISRLFPGR TDNAVKNHWH VITARKHRQH YSKLSASNNN ISTRCNHLPR TSTSSQSHYH  180
LNRAIYGNTH SISISINGNN KNSSNNNNND ATRGCLWSTW PRVVPRFPFG YLKHGIDDDH  240
DDVDDGVREN NKKKVLGDHV HDRHHELLPF SNDDDQIREV EEQGDDEIIR VMYKEEEDAP  300
NFIDFLGVGT *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-30441465107B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.15e-63myb domain protein 52